ZNF35 antibody - N-terminal region (ARP37722_P050)

This is a rabbit polyclonal antibody against ZNF35. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
Gene Symbol: ZNF35
Label: Human Jurkat
Protein Size: 519
Molecular Weight: 58kDa
Gene ID: 7584
Host: Rabbit
Application: WB
Clone: Polyclonal
Predicted Homology Based on Immunogen Sequence: Human
Peptide Sequence: ASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQEA