FOXP1 (Forkhead Box Protein P1, HSPC215, 12CC4, FLJ23741, hFKH1B, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (FITC), 126958-FITC-100ul

FOXP1, an 85kD member of the winged helix/forkhead transcription factor family. The FOXP1 transcription factor is widely expressed in human tissues and is predominantly localised to the nucleus. However, the level of expression does vary between cells and between different tissues. The expression of FOXP1 is reported to be abnormal in a range of solid tumors. Studies suggest that FOXP1 functions as a transcriptional repressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF*