CALB2-antibody--Nterminal-region-ARP58600P050

This is a rabbit polyclonal antibody against CALB2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
Gene Symbol: CALB2
Protein Size: 271
Molecular Weight: 30kDa
Gene ID: 794
Host: Rabbit
Application: WB
Clone: Polyclonal
Predicted Homology Based on Immunogen Sequence: Bovine, Horse, Human, Mouse, Pig, Rat, Zebrafish
Peptide Sequence: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD