CALB1 antibody - C-terminal region (ARP60104_P050)

This is a rabbit polyclonal antibody against CALB1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
Gene Symbol: CALB1
Protein Size: 261
Molecular Weight: 30kDa
Gene ID: 793
Host: Rabbit
Application: IHC, WB
Clone: Polyclonal
Predicted Homology Based on Immunogen Sequence: Bovine, Dog, Guinea pig, Horse, Human, Pig, African clawed frog, Mouse, Rat, Chicken
Peptide Sequence: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM